PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G25210.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 298aa    MW: 32056.9 Da    PI: 7.2562
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G25210.6genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.11.9e-0898142852
                      HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++ 
  OPUNC06G25210.6  98 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNH 142
                      55566**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.9E-1389159No hitNo description
SMARTSM003384.9E-889158IPR004827Basic-leucine zipper domain
PfamPF077161.2E-1493148IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-795142No hitNo description
CDDcd146867.47E-12103150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009644Biological Processresponse to high light intensity
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0005886Cellular Componentplasma membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDDGDLDFSN PDTFLCPAVG GADPDGSCSM DSYFDDILKD TEHHACTHTH TCNPPVHDLS  60
HTHTCVHVHT KIVSAPSDTP SDAAETAESP TENNASKKRP SGNRAAVRKY REKKKAHTAS  120
LEEEVVHLRA LNQQLMKKLQ NHAALEAEVS RLRCLLVDIR GRIEGEIGAF PYQRPVKNID  180
LVSSVDQGSY LGGAQVMNSC DFRCADQMYC SPGMPVKTMG EDGAVSGQVL GQGACDIVSI  240
QCTGAKSGST KLPVCGAMGR ERGWRGGRSG GDRGGRWGKG AEATRRRRNG CCISVEKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0917740.0AC091774.7 Oryza sativa chromosome 6 BAC OJ1540_H01 genomic sequence, complete sequence.
GenBankAK0716390.0AK071639.1 Oryza sativa Japonica Group cDNA clone:J023099K10, full insert sequence.
GenBankAK1039680.0AK103968.1 Oryza sativa Japonica Group cDNA clone:001-016-A09, full insert sequence.
GenBankAP0036140.0AP003614.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0481E08.
GenBankAP0037690.0AP003769.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0541C02.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642505.10.0PREDICTED: uncharacterized protein LOC4342078
RefseqXP_015642506.10.0PREDICTED: uncharacterized protein LOC4342078
SwissprotQ8VY762e-75BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0E0LFQ50.0A0A0E0LFQ5_ORYPU; Uncharacterized protein
TrEMBLA0A0E0LFQ90.0A0A0E0LFQ9_ORYPU; Uncharacterized protein
STRINGBGIOSGA020526-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g50310.10.0(Oryza sativa Japonica Group)
STRINGORGLA06G0232500.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.19e-67bZIP family protein